DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and AT5G12910

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_196795.1 Gene:AT5G12910 / 831131 AraportID:AT5G12910 Length:131 Species:Arabidopsis thaliana


Alignment Length:124 Identity:38/124 - (30%)
Similarity:56/124 - (45%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 VAAQNQTRRR----KAAN-----------PMSRAKRMD------REIRRLQHHPGTLIPKLPFSR 155
            :|..|||.|:    ||.:           |:.:..|..      ||||:.|.....:|.||||.|
plant     1 MARSNQTARKATGGKAPHFAMRVWQHSTPPLKKPYRYKPGTVALREIRKYQKTTDLVIRKLPFQR 65

  Fly   156 LVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMAL 214
            ||:|.......|  ||...||:.|:||:.|.::.....|:.:...|..|.|:..:|:.|
plant    66 LVKEIAQSLKAD--LRFQTGAVSALQEAAEAFMVGMFEDTNLCAMHAKRSTIMPKDIQL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 29/80 (36%)
AT5G12910NP_196795.1 H4 1..130 CDD:419976 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.