DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and cenpa

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001016585.1 Gene:cenpa / 549339 XenbaseID:XB-GENE-484234 Length:150 Species:Xenopus tropicalis


Alignment Length:157 Identity:54/157 - (34%)
Similarity:75/157 - (47%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAK-- 131
            ||:|          :::|.|...||..      ..:.||:.|..:|..| |:...|.|..|.:  
 Frog     7 PASR----------RKSRPPRRVSPPL------PTTSTRSPGRPSAPEQ-RKAPRATPKKRFRPG 54

  Fly   132 -RMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADS 195
             |...|||:.|.....||.|.||||||||..:.|:..........||:|:||:.|.:|.:...||
 Frog    55 TRALMEIRKYQKSTELLIRKAPFSRLVREVCMTYACGLNYSWQSMALMALQEASEAFLVRLFEDS 119

  Fly   196 YMLTKHRNRVTLEVRDMALMAYICDRG 222
            |:.:.|..||||.|:|:.|...|  ||
 Frog   120 YLCSLHAKRVTLYVQDIQLARRI--RG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 34/83 (41%)
cenpaNP_001016585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 16/65 (25%)
H3 44..144 CDD:128705 39/101 (39%)
H3-like 53..150 38/94 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.