DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and H3-5

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001013721.2 Gene:H3-5 / 440093 HGNCID:33164 Length:135 Species:Homo sapiens


Alignment Length:179 Identity:55/179 - (30%)
Similarity:70/179 - (39%) Gaps:56/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRSSTLRRDAGRRQP-------AARDS--STSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAG 110
            |...|.|:..|.:.|       |||.|  ||.|.   :.:||                    ..|
Human     3 RTKQTARKSTGGKAPRKQLATKAARKSTPSTCGV---KPHRY--------------------RPG 44

  Fly   111 PVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEG 175
            .||.                    |||||.|.....||.||||.|||||....::.|  ||....
Human    45 TVAL--------------------REIRRYQKSTELLIRKLPFQRLVREIAQDFNTD--LRFQSA 87

  Fly   176 ALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQ 224
            |:.|:||:.|.||...|.|:.:...|..|||:..:|:.|...|  ||.:
Human    88 AVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRI--RGER 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 35/83 (42%)
H3-5NP_001013721.2 PTZ00018 1..135 CDD:185400 55/179 (31%)
Histone 1..131 CDD:278551 53/174 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.