DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and H3Y1

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001342187.1 Gene:H3Y1 / 391769 HGNCID:43735 Length:136 Species:Homo sapiens


Alignment Length:138 Identity:50/138 - (36%)
Similarity:63/138 - (45%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RSPQT-RRMTVQQESK----TRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQ 141
            |:.|| |:.|..|..:    |:|||           |.|.|....|:..         ||||:.|
Human     3 RTKQTARKATAWQAPRKPLATKAAG-----------KRAPPTGGIKKPHRYKPGTLALREIRKYQ 56

  Fly   142 HHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVT 206
            .....|:.||||.|||||.....|.|  ||....|:.|:||:.|.||.|...|:.:...|..|||
Human    57 KSTQLLLRKLPFQRLVREIAQAISPD--LRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVT 119

  Fly   207 LEVRDMAL 214
            :..|||.|
Human   120 IMPRDMQL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 38/98 (39%)
H3Y1NP_001342187.1 HFD_SF 1..134 CDD:480273 50/138 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 14/50 (28%)

Return to query results.
Submit another query.