DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and h3f3c

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_956297.1 Gene:h3f3c / 336231 ZFINID:ZDB-GENE-030131-8175 Length:136 Species:Danio rerio


Alignment Length:177 Identity:52/177 - (29%)
Similarity:67/177 - (37%) Gaps:51/177 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRSSTLRRDAGRRQP-------AARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPV 112
            |...|.|:..|.:.|       |||.|:.|.....:.:||                    ..|.|
Zfish     3 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRY--------------------RPGTV 47

  Fly   113 AAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGAL 177
            |.                    |||||.|.....||.||||.|||||....:..|  ||....|:
Zfish    48 AL--------------------REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LRFQSAAI 90

  Fly   178 LAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQ 224
            .|:||:.|.||.....|:.:...|..|||:..:|:.|...|  ||.:
Zfish    91 GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI--RGER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 34/92 (37%)
h3f3cNP_956297.1 PTZ00018 1..136 CDD:185400 52/177 (29%)

Return to query results.
Submit another query.