DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and H3c11

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_835514.1 Gene:H3c11 / 319153 MGIID:2448350 Length:136 Species:Mus musculus


Alignment Length:148 Identity:49/148 - (33%)
Similarity:68/148 - (45%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RSPQTRRMTV-----QQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQ 141
            |:.||.|.:.     :::..|:||           ||:|......|:..         |||||.|
Mouse     3 RTKQTARKSTGGKAPRKQLATKAA-----------RKSAPATGGVKKPHRYRPGTVALREIRRYQ 56

  Fly   142 HHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVT 206
            .....||.||||.|||||....:..|  ||....|::|:||:||.||.....|:.:...|..|||
Mouse    57 KSTELLIRKLPFQRLVREIAQDFKTD--LRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVT 119

  Fly   207 LEVRDMALMAYICDRGRQ 224
            :..:|:.|...|  ||.:
Mouse   120 IMPKDIQLARRI--RGER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 35/83 (42%)
H3c11NP_835514.1 PTZ00018 1..136 CDD:185400 49/148 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.