DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and HFE

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_000401.1 Gene:HFE / 3077 HGNCID:4886 Length:348 Species:Homo sapiens


Alignment Length:81 Identity:21/81 - (25%)
Similarity:32/81 - (39%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTTSQLTLQDN---NRRSSTLRRDAGRRQPAARDSSTSG------EEEDQENRYPTT---RSPQT 95
            ||....|:.:|   ::.|.||:...|...  ..|:||.|      :.:|.....|.|   |:.:.
Human    98 FTVDFWTIMENHNHSKESHTLQVILGCEM--QEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEP 160

  Fly    96 RRMTVQQE---SKTRA 108
            |....:.|   .|.||
Human   161 RAWPTKLEWERHKIRA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976
HFENP_000401.1 Alpha-1 23..114 4/15 (27%)
MHC_I 27..202 CDD:298647 21/81 (26%)
Alpha-2 115..205 17/64 (27%)
IgC_MHC_I_alpha3 206..298 CDD:143322
Alpha-3 206..297
Connecting peptide 298..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.