DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and Cenpa

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001100181.1 Gene:Cenpa / 298850 RGDID:1563607 Length:159 Species:Rattus norvegicus


Alignment Length:172 Identity:56/172 - (32%)
Similarity:77/172 - (44%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RRDAG--RRQPA--ARDSSTSGEEEDQENRYPTTR--SPQTRRMTVQQESKTRAAGPVAAQNQTR 119
            ||..|  ||:|:  |...|....:..:::|.||.|  ||              |.||      :|
  Rat     4 RRKPGTPRRRPSSPAPGPSQPATDSRRQSRTPTRRPSSP--------------APGP------SR 48

  Fly   120 RRKAANPMSRAKRMD----REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAM 180
            |.....|.:..:|..    :||:.||.....|..|.||..:|||...|:|....|.....||||:
  Rat    49 RSSGVGPQALHRRRRFLWLKEIKNLQKSTDLLFRKKPFGLVVREICGKFSRGVDLYWQAQALLAL 113

  Fly   181 QESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRG 222
            ||:.|.:|.....|:|:|:.|..||||..:|:.|...|  ||
  Rat   114 QEAAEAFLVHLFEDAYLLSLHAGRVTLFPKDVQLARRI--RG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 32/83 (39%)
CenpaNP_001100181.1 DUF4554 <5..73 CDD:291750 22/87 (25%)
Histone 29..152 CDD:278551 46/144 (32%)
H3 59..156 CDD:128705 36/97 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.