DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and cnp1

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_596473.1 Gene:cnp1 / 2539658 PomBaseID:SPBC1105.17 Length:120 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:42/107 - (39%)
Similarity:55/107 - (51%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVR----EFIVKYSDDEPLRVTEGALLAM 180
            |:|...|.:.|.   ||||:.|.....||.:|||||:||    ||:..:|.|..||....||..:
pombe    18 RKKRYRPGTTAL---REIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTDVGLRWQSTALQCL 79

  Fly   181 QESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRG 222
            ||:.|.:|.....|:.:...|..|||:..|||.|...|  ||
pombe    80 QEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRI--RG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 37/96 (39%)
cnp1NP_596473.1 HFD_H3 20..119 CDD:467036 39/103 (38%)

Return to query results.
Submit another query.