DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and ZC155.2

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_498108.1 Gene:ZC155.2 / 191089 WormBaseID:WBGene00022530 Length:213 Species:Caenorhabditis elegans


Alignment Length:221 Identity:48/221 - (21%)
Similarity:79/221 - (35%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFT-TSQLTLQDNNRRS--STLRRD------AGRR 67
            |.|.|:...||..:...|...|:.......:.| |.:::|.:...:|  ||...|      :..|
 Worm     3 RVSINSFLEPNSPNVPNRVTIPDGDLRRNSDDTATDRISLTNQLGKSAYSTTTEDSIDSETSETR 67

  Fly    68 QPAARDSSTSG---EEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSR 129
            ..::|.|..||   |:...||:|....|..:..:.|..|          ....|.|.||:   .|
 Worm    68 MDSSRTSEISGNVKEDPVSENQYVLENSESSESIVVDLE----------MPGMTLRSKAS---PR 119

  Fly   130 AKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVK--YSDDEPLRVTEGALLAMQESCEMYLTQRL 192
            .:.|.::.:.|...      |..|..||......  ...||..::|:.|:..:|...:..|.:..
 Worm   120 KRYMSKKEKDLNDE------KKNFKDLVLTIGQNQIQDPDEDFQITKEAIDLLQSESDKILLEMF 178

  Fly   193 ADSYMLTKHRNRVTLEVRDMALMAYI 218
            ..|..:.....|..|...|:....:|
 Worm   179 TSSNAIATAGERDILTPTDIQTARHI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 16/86 (19%)
ZC155.2NP_498108.1 H4 120..204 CDD:390056 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11426
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.