DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and cpar-1

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_499073.1 Gene:cpar-1 / 186223 WormBaseID:WBGene00010036 Length:261 Species:Caenorhabditis elegans


Alignment Length:164 Identity:48/164 - (29%)
Similarity:72/164 - (43%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RRQPAARDSSTSGEEEDQE-----NRYPT--TRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKA 123
            ||..::.:..|:.....|.     ||..|  |......|.......:.|.   :|.:|:..:.:.
 Worm   102 RRHDSSDEEITAANSHHQSPINVGNRNDTDGTNGRNGSRAGSSSSDRVRM---IAGRNRISKTRR 163

  Fly   124 ANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFI---VKYSDDEPLRVTEGALLAMQESCE 185
            ..|..:|.   .|||:.|.....||||.||:|||||.:   ..:|.|  ||:...|:.|:||:.|
 Worm   164 YRPGQKAL---EEIRKYQESEDLLIPKAPFARLVREIMQTSTPFSSD--LRIRSDAINALQEASE 223

  Fly   186 MYLTQRLADSYMLTKHRNRVTLEVRDMALMAYIC 219
            ..|.|....|.:::.|..|.||...|:.|...:|
 Worm   224 ALLVQMFDGSSLISAHSKRATLTTTDVQLYRRLC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 33/86 (38%)
cpar-1NP_499073.1 Histone 132..257 CDD:278551 40/132 (30%)
H3 156..261 CDD:128705 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I4033
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.