DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and F20D6.9

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_505106.1 Gene:F20D6.9 / 184727 WormBaseID:WBGene00017638 Length:118 Species:Caenorhabditis elegans


Alignment Length:78 Identity:25/78 - (32%)
Similarity:38/78 - (48%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLT 199
            ||||:.|.....|||:..|.|||:|....:..|  |...:.|:.|:|.:.|.||.:......:..
 Worm    32 REIRKQQQSTELLIPRSRFERLVKELAQDFVTD--LIFRKDAIDALQAAVEDYLVELFRLGNLCA 94

  Fly   200 KHRNRVTLEVRDM 212
            ....|||:|..::
 Worm    95 IKCKRVTIEADNL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 25/78 (32%)
F20D6.9NP_505106.1 HFD_H3 22..115 CDD:467036 25/78 (32%)

Return to query results.
Submit another query.