DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and hcp-3

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_499128.1 Gene:hcp-3 / 176359 WormBaseID:WBGene00001831 Length:288 Species:Caenorhabditis elegans


Alignment Length:247 Identity:59/247 - (23%)
Similarity:96/247 - (38%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTL-----------RRDAGRRQP 69
            |..|...:||.|         .|| .|....::.|....|....|           |::..||:.
 Worm    53 NQYKKELEDDAA---------NDY-TEAHIHKIRLVTGKRNQYVLKLKQAEDEYHARKEQARRRA 107

  Fly    70 AARD-----SSTS----------------GEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVA 113
            ::.|     :||:                .:..|:||......:....|.......:....|| :
 Worm   108 SSMDFTVGRNSTNLVDYSHGRHHMPSYRRHDSSDEENYSMDGTNGDGNRAGPSNPDRGNRTGP-S 171

  Fly   114 AQNQTRRRKAANPMSRAKRMD------REIRRLQHHPGTLIPKLPFSRLVREFI---VKYSDDEP 169
            :.::.|.|...|.:::.:|..      .|||:.|.....||.|.||:|||||.:   ..:..|  
 Worm   172 SSDRVRMRAGRNRVTKTRRYRPGQKALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPFGAD-- 234

  Fly   170 LRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDR 221
            .|:...|:.|:||:.|.:|.:....|.:::.|..||||...|:.|...:|.|
 Worm   235 CRIRSDAISALQEAAEAFLVEMFEGSSLISTHAKRVTLMTTDIQLYRRLCLR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 30/86 (35%)
hcp-3NP_499128.1 Histone 156..284 CDD:278551 37/130 (28%)
H3 183..288 CDD:128705 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I4033
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.