DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and CENPA

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001800.1 Gene:CENPA / 1058 HGNCID:1851 Length:140 Species:Homo sapiens


Alignment Length:132 Identity:48/132 - (36%)
Similarity:67/132 - (50%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRMTVQQESKTRAAGPVAAQNQTRRRKA--ANPMSRAKRMD---REIRRLQHHPGTLIPKLPFSR 155
            ||....:..:.|:..|......:||..:  |:....::|..   :|||:||.....||.||||||
Human     5 RRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSR 69

  Fly   156 LVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICD 220
            |.||..||::..........||||:||:.|.:|.....|:|:||.|..||||..:|:.|...|  
Human    70 LAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRI-- 132

  Fly   221 RG 222
            ||
Human   133 RG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 37/83 (45%)
CENPANP_001800.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 8/40 (20%)
H3 34..137 CDD:128705 42/103 (41%)
Important for flexibility of DNA ends that protrude from nucleosomes. /evidence=ECO:0000269|PubMed:27499292 39..54 4/14 (29%)
CATD. /evidence=ECO:0000269|PubMed:15282608, ECO:0000269|PubMed:7962047 75..116 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.