DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and cenpa

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001157712.1 Gene:cenpa / 100302659 -ID:- Length:145 Species:Danio rerio


Alignment Length:144 Identity:47/144 - (32%)
Similarity:72/144 - (50%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRR---KAANPMSRAK-----RMDREIRRLQHHP 144
            |...|...|:.:..:.....|:.|..|.::|||.   ..::|..:.|     |...|||:.|...
Zfish     2 PRHTSAHKRKPSTPRRRSPPASLPPPAGSRTRRHSGPSGSSPRKKHKFRPGTRALMEIRKYQKST 66

  Fly   145 GTLIPKLPFSRLVREFIVKYSDDEPLRVTEG-ALLAMQESCEMYLTQRLADSYMLTKHRNRVTLE 208
            |.|:.|.||||||||....:|.:.  .:.:| ||:|:||:.|.::.:..:|:.:...|..||||.
Zfish    67 GLLLRKAPFSRLVREVCQMFSREH--MMWQGYALMALQEAAEAFMVRLFSDANLCAIHAKRVTLF 129

  Fly   209 VRDMALMAYICDRG 222
            .||:.|...|  ||
Zfish   130 PRDIQLARRI--RG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 32/84 (38%)
cenpaNP_001157712.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 11/51 (22%)
Histone 30..140 CDD:278551 39/113 (35%)
H4 44..144 CDD:304892 37/102 (36%)
H3-like 51..145 36/95 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.