DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbc and GRC3

DIOPT Version :9

Sequence 1:NP_610876.1 Gene:cbc / 36494 FlyBaseID:FBgn0033842 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_013065.1 Gene:GRC3 / 850624 SGDID:S000003958 Length:632 Species:Saccharomyces cerevisiae


Alignment Length:454 Identity:87/454 - (19%)
Similarity:159/454 - (35%) Gaps:122/454 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CVLHV----------SGKM--DVCYISKET----PMVQYVNCHAALEQFRME------------- 101
            |||.|          :|.:  ||.|:.|..    |:.:....|...|..|::             
Yeast   163 CVLRVFNSNHTGLLEAGHLYRDVNYLWKPKEPYFPLNERTTYHLLHESDRIQSLSVPGYWSTPLE 227

  Fly   102 ----AEEKDRYGPVAMVVGPMDVGKSTLCRILLNYAVRVGR-------RPLYADLDVGQGSIAIS 155
                :.:...|....||:|..:.||||..|:||....:..|       ..:|.|||.||...::.
Yeast   228 KLYLSHKNAAYDTRIMVIGGKNSGKSTFLRLLLEKFTQDIRDSTTSQEELVYLDLDPGQPEYSLP 292

  Fly   156 GSVA-TILIERPANVEEGFAKTAP----LVYHFGHKSPSGNSVLYNAVVSKMAEVTLQSLNSNKR 215
            .|:: ..::..|.::.:...:.:.    |.::.|..||......|.....|:.:      :..::
Yeast   293 DSISLNKILSSPISLGQHLCQGSNFQTLLQFYAGSSSPQDEPTSYLNCADKLID------HLEEQ 351

  Fly   216 TKSSGIIINTCGWVKGSGYAHLLHAAKAYGACAIFVLD---QERLYNEL---------LRD--VP 266
            ......::|..||:||.|...|.|..:.|....:..|:   .:|..:||         |||  .|
Yeast   352 AFFGTSLLNLPGWIKGFGMQILNHIIRKYKPTHLLFLETANSKRHLDELTIPQSFSTSLRDAYAP 416

  Fly   267 KGVHVVLLPKSGGVVERSKELRH---------EARDQRIKEYF---------------------- 300
            :   ||.:|        :..|.|         :.|..:|...|                      
Yeast   417 E---VVRVP--------AHSLNHTLSSRFHASQLRTFKILALFHKITQFDYDFAPLLKSAPLQIS 470

  Fly   301 YGNTRAPFYPFSFEVKFQDLRLYKIGAPPLPDSCMPIGMKAEDNKTKVVAVTPTPAL------IH 359
            ||..::......|.::||||....|.: .|..:.:.|...:.::..:|.::...|.|      ..
Yeast   471 YGKGKSGIKGIQFPMEFQDLNPQDIKS-ALEGTVIGIYTYSGEDSLEVKSLNTFPILQSCTSSSK 534

  Fly   360 HVLALSFAESVEDDVIGTNVAGFCCVTEV----DMERQAVMLLSPQPRP----LPPNALLLWSE 415
            :.:.|....|::......|:....|.|::    ..:.|.:::.:....|    ||....:.|.:
Yeast   535 NFITLGLIHSIDTSQQIMNIYVPPCHTQILDKQPEDAQWIIVRNKTETPFCDFLPSPRTITWDD 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbcNP_610876.1 CLP1_N 9..102 CDD:293181 13/68 (19%)
CLP1 11..412 CDD:227910 86/449 (19%)
CLP1_P 116..301 CDD:293183 48/241 (20%)
Clp1 309..420 CDD:284274 21/121 (17%)
GRC3NP_013065.1 Grc3 163..610 CDD:224260 87/454 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1583
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.