DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbc and CLPS5

DIOPT Version :9

Sequence 1:NP_610876.1 Gene:cbc / 36494 FlyBaseID:FBgn0033842 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_198809.2 Gene:CLPS5 / 833990 AraportID:AT5G39930 Length:424 Species:Arabidopsis thaliana


Alignment Length:411 Identity:144/411 - (35%)
Similarity:232/411 - (56%) Gaps:14/411 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LESDSELRFEIEQKDAKVLVSLVSGFAELFGTELVKKKQYEFGVGAKVAIFTYQGCVLHVSGKMD 75
            ||..||||.|: |..:.:.:.|:.|.||:||.||..:....|......|:||:.|..:.:.|...
plant    11 LEKQSELRIEL-QPTSPLRLRLLDGKAEIFGYELPHEVWITFPPLMTFAVFTWYGATIEIDGITG 74

  Fly    76 VCYISKETPMVQYVNCHAAL--EQFRMEAEEKD----RYGPVAMVVGPMDVGKSTLCRILLNYAV 134
            ..|||.|||||.|:..|.:|  ::.|:.:..:|    :.||..::||.:|.|||||.::|||:||
plant    75 NEYISCETPMVNYLGLHNSLQVQRHRVTSSTRDSASSQEGPRVIIVGDIDSGKSTLAKMLLNWAV 139

  Fly   135 RVGRRPLYADLDVGQGSIAISGSVATILIERPANVEEGFAKTAPLVYHFGHKSPSGNSVLYNAVV 199
            :.|.:|.:.||:|||.||.|.|::|...|:...:..|||.....|:::||..:||.|..||..:|
plant   140 KDGWKPTFVDLNVGQSSITIPGTIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRTLV 204

  Fly   200 SKMAEVTLQSLNSNKRTKSSGIIINTCGWVKGSGYAHLLHAAKAYGACAIFVLDQ-ERLYNELLR 263
            .::|....:..::|..:::||::|:|.|::...|||.||||.:.:.|..:.|:.| |:|..:|.:
plant   205 EELARELKEEFSANAESRASGMVIDTMGFIVREGYALLLHAIRTFNASLVIVVGQEEKLVYDLKK 269

  Fly   264 DV--PKGVHVVLLPKSGGVVERSKELRHEARDQRIKEYFYGNTRAPFYPFSFEVKFQDLRLYKIG 326
            ::  .|.:.|:.|.||.||..||.:.|...|:..|:.||||.|. ....::..|||.|:::|:||
plant   270 NLKFKKNLQVLNLEKSEGVFSRSSDFRKTLRNSNIQNYFYGVTN-DLTVYTKTVKFSDVQVYRIG 333

  Fly   327 APPLPDSCMPIGMKAEDNKTKVVAVTPTPALIHHVLALSFAESVEDDVIGTNVAGFCCVTEVDME 391
            ...:..|..  ..:..::..|:..||....|::.|||:|:|.. .|.:|.:.||||.|:..||:.
plant   334 DFRVSGSTS--AHQRGNDPLKITLVTIDEHLVNKVLAISYAIK-PDQIISSIVAGFVCIKNVDIS 395

  Fly   392 RQAVMLLSPQPRPLPPNALLL 412
            .:.:..:||....||...|:|
plant   396 EERITYVSPSAAELPSKILIL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbcNP_610876.1 CLP1_N 9..102 CDD:293181 34/92 (37%)
CLP1 11..412 CDD:227910 143/409 (35%)
CLP1_P 116..301 CDD:293183 70/187 (37%)
Clp1 309..420 CDD:284274 32/104 (31%)
CLPS5NP_198809.2 CLP1 6..421 CDD:227910 144/411 (35%)
CLP1_P 121..310 CDD:379861 71/188 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 173 1.000 Domainoid score I1123
eggNOG 1 0.900 - - E1_COG5623
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I811
OMA 1 1.010 - - QHG53868
OrthoDB 1 1.010 - - D814241at2759
OrthoFinder 1 1.000 - - FOG0003461
OrthoInspector 1 1.000 - - otm2750
orthoMCL 1 0.900 - - OOG6_101503
Panther 1 1.100 - - O PTHR12755
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3913
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.