DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbc and CG8414

DIOPT Version :9

Sequence 1:NP_610876.1 Gene:cbc / 36494 FlyBaseID:FBgn0033842 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_611084.2 Gene:CG8414 / 36774 FlyBaseID:FBgn0034073 Length:995 Species:Drosophila melanogaster


Alignment Length:464 Identity:97/464 - (20%)
Similarity:168/464 - (36%) Gaps:138/464 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDQGKDYTLESDSELRFEIE-QKDAKVLVSLVSGFAELFGT----------ELVKKKQYEFGVGA 56
            |:..|::|......::...: |.:|.||:...:...:|..|          .||......||...
  Fly   538 EELNKNFTRAQLDRIKTSFQRQTNAIVLLHRNTSAQQLVDTFGKHMAQNVFPLVNSSNRPFGQSE 602

  Fly    57 KVAIFTYQGCVLHVSGKMDVCYISKETPMVQYVNCHAALEQFRMEAEEKDRYGPVAMVVGPMDVG 121
                 |...|::..|.:      |:...:.|..|      :.:|.|..:      .:|.|...||
  Fly   603 -----TLLHCLIQSSDQ------SRTLQVPQVWN------KLQMHATSR------IIVAGGKGVG 644

  Fly   122 KSTLCRILLNYAVRVGRRP--LYADLDVGQGSIAISGSVATILIERPANVEEGFAKTAPLVYH-- 182
            ||:|.|.|:|.  .:|:.|  |..|||:||..|.:..:::..:|:.|. :..||      :|:  
  Fly   645 KSSLLRYLINR--NLGQFPSMLLIDLDIGQPEIFVPQTISCTVIDEPL-LGPGF------LYNRQ 700

  Fly   183 ------FGHKSPSGNSVLYNAVVSKMAEVTLQSLNSNKRTKSSGIIINTCGWVKGSG---YAHLL 238
                  .||.    |.||.....::.....:|::.::.:..:...:|||.|:.||.|   .|.|:
  Fly   701 PEHAIVVGHT----NIVLCAEQYARAVIQLVQNIQNDAKYSNIPWLINTMGYNKGFGIELMALLV 761

  Fly   239 HAAKAYGACAI----------FVLDQERL-------YNE---LLRDVPKG-----VHVVLLPKSG 278
            ...:......|          .|||:..|       |:.   .:.::||.     :..|...:.|
  Fly   762 DRIRPTDLVQIASPIPINNFDSVLDRNSLSQIKPIIYSAEEFKINEIPKYTLHKLISAVPAREKG 826

  Fly   279 GVVERSKELRHEARDQRIKEYFYGNTRAPFYPFSFEVKFQDLRLYKIGAPPLPDSCMPIGMKAED 343
            .....:|::|:.....|:.....||.::                       |.| |.|:|:..|.
  Fly   827 TWSLSAKDMRYSNLLARLSSCLTGNAKS-----------------------LTD-CQPLGVSLES 867

  Fly   344 NKTKVVAVTPTPALIHHVLALSFAESVEDDVIG--TNVAGFC--------C-----VTEVDMERQ 393
            .|            |.|..:.::  |.|:.:.|  .||...|        |     |..:|.||:
  Fly   868 LK------------ILHPTSKNY--SREELIRGMEANVVYLCHHGAGLPQCLGIGVVRAIDYERK 918

  Fly   394 AVMLLSPQP 402
            .:.|:...|
  Fly   919 ELYLVPAMP 927

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbcNP_610876.1 CLP1_N 9..102 CDD:293181 18/103 (17%)
CLP1 11..412 CDD:227910 94/456 (21%)
CLP1_P 116..301 CDD:293183 51/222 (23%)
Clp1 309..420 CDD:284274 22/109 (20%)
CG8414NP_611084.2 HC2 41..>163 CDD:284736
RNA_pol_3_Rpc31 <255..333 CDD:288542
P-loop_NTPase 639..824 CDD:304359 47/197 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12755
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.