DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbs and AT5G44310

DIOPT Version :9

Sequence 1:NP_610875.1 Gene:cbs / 36492 FlyBaseID:FBgn0086757 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_199244.1 Gene:AT5G44310 / 834454 AraportID:AT5G44310 Length:331 Species:Arabidopsis thaliana


Alignment Length:327 Identity:74/327 - (22%)
Similarity:135/327 - (41%) Gaps:70/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HLKKRMKIVEESRLESLGKL----------NSEQQVQALIREHKLLEQHLEEAHLQLSDIKGSWS 262
            |.|.|...||::| :|...|          :.|.......:.||..|:..::|:    |:|    
plant    46 HSKGRYDPVEKAR-DSRADLAYDSKKWREESGEYAEAGKGKAHKTKEEAKDKAY----DMK---- 101

  Fly   263 GQNLALETQVSRLSKQVAEETTEK--RKALKSRDDAIESR---KQVSFEL-EKAKDEIKQRDDKV 321
                       ..:|..||:|..|  ..|.::.|.|.|::   |..:::: ||.||..::..|||
plant   102 -----------ERTKDYAEQTKNKVNEGASRAADKAYETKEKAKDKAYDVKEKTKDYAEEAKDKV 155

  Fly   322 KLLEEEIDELSVALKECREENEQQVLFERNKSQNLETEVKDLKTRLTAADDRFSEYSSNAEQVAQ 386
            .      :..|.|..:..|..|:    .::|:.:::.:.||.      |::...:.:..|.:.|.
plant   156 N------EGASRAADKAYETKEK----AKDKAYDVKEKTKDF------AEETKEKVNEGASRAAD 204

  Fly   387 KLRVQVTEKQEQLDETIMQLEIEREEKMTAILRNAEIAQSEDILRQQLRLERSEASDLQERNNQL 451
            | ...|.||.:...|   |.:.:..|..:.....||  :::|..:......:.:|.|:.....:.
plant   205 K-AYDVKEKTKNYAE---QTKDKVNEGASRAADKAE--ETKDKAKDYAEDSKEKAEDMAHGFKEK 263

  Fly   452 VRDISE-ARQTLQQVSSTAQDNADKLTEFERVQLEII----EKNKTIKTLNQRLIDLKKTVQKEL 511
            .:||.| ...|::.|..||:..|.|:||      .::    |.:|....:::.|.||.|.. ||.
plant   264 AQDIGEKTMDTVKDVWETAKSTAQKVTE------AVVGSGEEADKARDDVDKGLEDLSKKA-KEN 321

  Fly   512 RS 513
            |:
plant   322 RN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbsNP_610875.1 AmyAc_family <276..>372 CDD:298606 25/101 (25%)
Grip 553..598 CDD:197860
AT5G44310NP_199244.1 Apolipoprotein 91..265 CDD:279749 43/214 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.