DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cbs and Y45F10B.8

DIOPT Version :9

Sequence 1:NP_610875.1 Gene:cbs / 36492 FlyBaseID:FBgn0086757 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_502615.1 Gene:Y45F10B.8 / 189918 WormBaseID:WBGene00012872 Length:244 Species:Caenorhabditis elegans


Alignment Length:217 Identity:46/217 - (21%)
Similarity:100/217 - (46%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 KRMKIVEESRLESLGKLNSEQQVQALIREHKLLEQHLEEAHLQLSDIKGSWSGQNLALETQVSRL 275
            |.:|.:|  ...|....|..|.:..|.||       ||: |:.:.:.|.....:||.|:..:...
 Worm     2 KSLKFME--NFISTVPFNMWQNMAKLKRE-------LED-HIDMPEQKAEKFFENLQLDIMIMAA 56

  Fly   276 SKQVAEETTEKRKALKSRDDAIESRKQVSFELEKAK---DEIKQRDDKVKLLEEEIDELSVALKE 337
            .|.:|.:..:..|      .|:.:::.::..|:|..   |::::.::::|:|:|::|:|...:.:
 Worm    57 EKDIATDEVDSVK------QALMNQQMITQHLKKRNEYLDDLEEANERIKILDEKLDKLEAKISK 115

  Fly   338 CREENEQQVLFERNKSQNLETEVKDLKTRLTAADDRFSEYSSNAEQVAQKLRVQVTEKQE----- 397
            ..|...|.|.....|.:.|:|..|::|    ..||..|.:    :|...:|:....|.::     
 Worm   116 TEESLVQSVSMLLEKDEQLKTIRKEMK----IMDDERSAF----DQELTRLKTSRLENEKSSLAS 172

  Fly   398 QLDETIMQLEIEREEKMTAILR 419
            :::.||..|..:.|.::..:::
 Worm   173 RVECTICYLSYDNEARVPRVMK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cbsNP_610875.1 AmyAc_family <276..>372 CDD:298606 20/98 (20%)
Grip 553..598 CDD:197860
Y45F10B.8NP_502615.1 Smc 20..>175 CDD:224117 37/176 (21%)
RING_Ubox 175..221 CDD:388418 4/20 (20%)
RING-HC finger (C3HC4-type) 176..220 CDD:319361 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.