DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS27

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:239 Identity:79/239 - (33%)
Similarity:120/239 - (50%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYG 98
            |:|||..:...:.|||||:||:||||||||:|:...::|||||....:..|..::..|:.:....
Human    34 RMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQP 98

  Fly    99 G---VLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITM--ASATPAHGSAASISGW 158
            |   :...|..::::..|...:...|:.:|.|:..:.|.:.|..:.:  .|.....|....::||
Human    99 GPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGW 163

  Fly   159 GKTSTDG--PSSATLLFVDTRIVGRSQCG-----SSTYGY-GSFIKATMICAA--ATNKDACQGD 213
            |..|.:.  |....|..:...|:...:|.     .:.:|| ...||..|:||.  ...||||:||
Human   164 GSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGD 228

  Fly   214 SGGPLVS-GGQ---LVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ||||||. .||   ..||:|||..||..|.||||..:....:|:
Human   229 SGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 78/237 (33%)
Tryp_SPc 35..253 CDD:238113 77/236 (33%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 78/237 (33%)
Tryp_SPc 36..275 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.