DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and prss60.1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:265 Identity:97/265 - (36%)
Similarity:140/265 - (52%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPI---GLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRS--GSHFCGGSIISNN 68
            ||||....|:...:   ||.|    |..|||||..:.....||||||...  |.||||||:|::.
Zfish     9 LALLLCVQGSHSQLNVCGLAP----LNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSE 69

  Fly    69 IIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLV-----EVAAIKAHEAYNSNSKINDIGVVRLK 128
            .::||||||...|| |:|.:..|  |.|..||..     .|:.|..|.:||:.:..|||.::.|.
Zfish    70 WVLTAAHCLPRITT-SSLLVFLG--KTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLS 131

  Fly   129 TKLTFGSTIKAITMASATPA--HGSAASISGWG--KTSTDGPSSATLLFVDTRIVGRSQCGSSTY 189
            :.:||.:.|:.:.:|:....  :|:::.|:|||  :...:.|:...|......:|...|| ::..
Zfish   132 SAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-NALL 195

  Fly   190 GYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLV----GVVSWGRDCAVANYPGVYANIAE 248
            |.|| :...||||...  .:|.||||||||:||...||    |:.|||..||....||||..:::
Zfish   196 GSGS-VTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQ 259

  Fly   249 LRDWV 253
            .:.|:
Zfish   260 YQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 87/235 (37%)
Tryp_SPc 35..253 CDD:238113 86/234 (37%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 87/235 (37%)
Tryp_SPc 34..267 CDD:238113 87/236 (37%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.