DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss8

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:273 Identity:90/273 - (32%)
Similarity:134/273 - (49%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFLALLALTNGAVIPIGLEPQTSSLGG----RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67
            |.|.||.|....:...|.|   :|.|.    ||.||.::.....|||||:...|:|.||||::||
Mouse    16 TILLLLGLLQSGIRADGTE---ASCGAVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSN 77

  Fly    68 NIIVTAAHCLDTPTTVSNLRIRAGSNK-RTYGG--VLVEVAAIKAHEAYNSNSKINDIGVVRLKT 129
            ..:|:||||.....:.....::.|::: .:|..  |:..||.|..|.:|.......||.::||.:
Mouse    78 KWVVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSS 142

  Fly   130 KLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTDGPSSA-----TLLFVDTRIVGRSQCGSS 187
            .:||...|:.|.:  |:|:..:|...:::|||..:   ||.:     .|..::..::.|..| |.
Mouse   143 PVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVA---PSVSLQTPRPLQQLEVPLISRETC-SC 203

  Fly   188 TYGYGSF------IKATMICAAAT--NKDACQGDSGGPL---VSG-GQLVGVVSWGRDCAVANYP 240
            .|...:.      |:..|:||...  .||||||||||||   :.| ..|.|:||||..|...|.|
Mouse   204 LYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRP 268

  Fly   241 GVYANIAELRDWV 253
            |||...:....|:
Mouse   269 GVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/240 (33%)
Tryp_SPc 35..253 CDD:238113 79/239 (33%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.