DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:262 Identity:84/262 - (32%)
Similarity:127/262 - (48%) Gaps:26/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNI 69
            |.||...|    ||.:.:   |..|.  .:||||........|:||||....||.||||:||:..
Mouse     3 IITFFTFL----GAAVAL---PANSD--DKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQW 58

  Fly    70 IVTAAHCLDTPTTVSNLRIRAGSNKRTY---GGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKL 131
            :::||||..     ..|::|.|.:....   |...::...|..|..||.::..|||.:::||:..
Mouse    59 VLSAAHCYK-----RRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPA 118

  Fly   132 TFGSTIKAITMASATPAHGSAASISGWGKT-STDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFI 195
            ...|.:..:::..:..:..:...:||||.| |..|...|.|..::..::..|.|..|   |...|
Mouse   119 ILNSQVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS---YPGQI 180

  Fly   196 KATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQK 258
            .:.|.|..  ...||:|.||||||:|..|::.|:||||..||:...||||..:.....|:   |:
Mouse   181 TSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI---QE 242

  Fly   259 TV 260
            |:
Mouse   243 TM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 73/224 (33%)
Tryp_SPc 35..253 CDD:238113 73/223 (33%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 73/224 (33%)
Tryp_SPc 24..243 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.