DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss55

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:247 Identity:90/247 - (36%)
Similarity:130/247 - (52%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLD----TPTTVSNLRIRAGSNK 94
            ||:.|..:.:.:.|||||:|.|..|||||||:|...|:|.|||..    :||   :||:|.|:|.
Mouse    60 RIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQELSPT---DLRVRVGTND 121

  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAAS----- 154
            .|...|.:||..|..|:.:...:..|||.::.|...|||..    :|:....|...:..|     
Mouse   122 LTTSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNE----LTVPICLPLWPAPPSWHECW 182

  Fly   155 ISGWGKT-STDGPSSAT-LLFVDTRIVGRSQCGSSTYGYGSF--IKATMICAAATNK--DACQGD 213
            ::|||.| |||..|.:| |:.|..||:...:|      ...|  :...|:||:..|:  ||||||
Mouse   183 VAGWGVTNSTDKESMSTDLMKVPMRIIEWEEC------LQMFPSLTTNMLCASYGNESYDACQGD 241

  Fly   214 SGGPLV------SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKT 259
            ||||||      |....||::|||:.|....:||:|..:|:...|:.:..:|
Mouse   242 SGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 88/239 (37%)
Tryp_SPc 35..253 CDD:238113 87/238 (37%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 88/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.