DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss41

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:279 Identity:82/279 - (29%)
Similarity:124/279 - (44%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68
            |.:|.:.||::      |.|....|.|   |||||..|.....|||.||:...||.||||::|..
Mouse    62 LKSTDIKLLSM------PCGRRNDTRS---RIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRR 117

  Fly    69 IIVTAAHCLDTPTTVSNLRIRAGS--------NKRTYGG------VLVEVAAIKAHEAYNSNSKI 119
            .::|||||...........::.|.        |::.|.|      ::|           ||..|:
Mouse   118 WVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIV-----------NSEDKL 171

  Fly   120 --NDIGVVRLKTKLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTD---GPSSATLLFVDTR 177
              :|:.::||.:.:|:...|:.:.:  ::.|..|.....::|||....|   .|....|..|...
Mouse   172 KSHDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVS 236

  Fly   178 IVGRSQCGS--STYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSG----GQLVGVVSWGRDC 234
            |:..|:|..  ..:.....|...:.||.|.  :.|.|.||||||||..    ...:|:||||..|
Mouse   237 ILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGC 301

  Fly   235 AVANYPGVYANIAELRDWV 253
            ...|.||:|.|::...:|:
Mouse   302 GRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 73/247 (30%)
Tryp_SPc 35..253 CDD:238113 72/246 (29%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.