DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss41

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:277 Identity:74/277 - (26%)
Similarity:122/277 - (44%) Gaps:51/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIV 71
            |.:.||::      |.|   :.:.:..|||||..|.....|||.||:....|.||||::|:..::
  Rat    36 TDIKLLSM------PCG---RRNDIRSRIVGGIESVRGRWPWQASLRLRKFHRCGGSLLSHRWVL 91

  Fly    72 TAAHCLDTPTTVSNLRIRAGS--------NKRTYGG------VLVEVAAIKAHEAYNSNSKI--N 120
            |||||...........::.|.        |:..:.|      :::           ||..|:  :
  Rat    92 TAAHCFRKFLDPKKWTVQLGQLTSKPSFWNREAFSGRYRVKDIII-----------NSEDKLKYH 145

  Fly   121 DIGVVRLKTKLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTD---GPSSATLLFVDTRIVG 180
            |:.::||.:.:|:...|:.:.:  :::...|.....::|||....|   .|....|..|...::.
  Rat   146 DLALLRLASSVTYNKFIQPVCVLPSASMSQHQPRCWVTGWGALQEDLKPLPPPYHLREVQVTVLN 210

  Fly   181 RSQCGSSTYGYGS---FIKATMICAAAT--NKDACQGDSGGPLVSG----GQLVGVVSWGRDCAV 236
            .|:| ...:.:.|   .|...:.||.|.  :.|.|.||||||||..    ...:|:||.|..|..
  Rat   211 LSRC-QELFSFASRYHLITRDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGR 274

  Fly   237 ANYPGVYANIAELRDWV 253
            ...||:|.|::...||:
  Rat   275 PKLPGIYTNVSHHYDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 68/248 (27%)
Tryp_SPc 35..253 CDD:238113 67/247 (27%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 68/248 (27%)
Tryp_SPc 55..292 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.