DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and prss1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:252 Identity:90/252 - (35%)
Similarity:135/252 - (53%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |||.|:...|  |:|.:..      :||||...:....|:|||| .||.||||||:|||..:|:|
Zfish     7 LALFAVAYAA--PLGDDDD------KIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVSA 62

  Fly    74 AHCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFG 134
            |||..:...|    .|:.:..|:.:      .:....:..|.:||||:..||:.:::|.:.....
Zfish    63 AHCYKSRVQVRLGEHNIDVTEGTEQ------FINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQIN 121

  Fly   135 STIKAITMASATPAHGSAASISGWGKTSTDGPS-SATLLFVDTRIVGRSQCGSSTYGYGSFIKAT 198
            |.:|.:::.|:..:.|::..|||||..|..|.: .:.|:.::..|:..|.|.::   |...|.:.
Zfish   122 SYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNA---YPGQISSN 183

  Fly   199 MICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |.||.  ...||:||||||||:|...||.|:||||..||..|.|||||.:.....|:
Zfish   184 MFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/225 (36%)
Tryp_SPc 35..253 CDD:238113 82/224 (37%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 82/225 (36%)
Tryp_SPc 25..243 CDD:238113 83/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.