DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and zgc:123295

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:263 Identity:101/263 - (38%)
Similarity:148/263 - (56%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLALTNGAVIPI---GLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRS--GSHFCGGSIISNNI 69
            |||....|::..:   |..|    |..:||||..:.....|||||||..  |.||||||:|:.:.
Zfish    12 ALLVNIAGSLCQLNVCGRAP----LNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDW 72

  Fly    70 IVTAAHCL-DTPTTVS---NLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTK 130
            :::||||. |:..|:.   .|:.::|||.......:|:|.   .|..||:.|..|||.:|:|.:.
Zfish    73 VLSAAHCFQDSIGTIMVKLGLQSQSGSNPYQITKTVVQVI---NHPNYNNPSNDNDIALVKLDSS 134

  Fly   131 LTFGSTIKAITMASA--TPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYG 192
            :||...|:.:.:|:|  |.|.|:.:.::||||.|:.......:| .|:..||..|.|..:   |.
Zfish   135 VTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRA---YP 196

  Fly   193 SFIKATMICAAATN---KDACQGDSGGPLVS--GGQLV--GVVSWGRDCAVANYPGVYANIAELR 250
            ..|.:.||||...:   ||:||||||||:||  |.|.:  |:||:||.||...||||||.:::.:
Zfish   197 GEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQ 261

  Fly   251 DWV 253
            ||:
Zfish   262 DWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 93/234 (40%)
Tryp_SPc 35..253 CDD:238113 93/233 (40%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 93/234 (40%)
Tryp_SPc 36..264 CDD:238113 93/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.