DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG17234

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:107/262 - (40%)
Similarity:140/262 - (53%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67
            :.|.:||.||||.   .:..|   |.:....||:||....||..|||||||..|.|.|||||.|.
  Fly     1 MFIESFLLLLALD---FLSAG---QVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSE 59

  Fly    68 NIIVTAAHC--------LDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGV 124
            |||||||||        ||.    ...::||||......|.||:|||:..||.|..:..||||.:
  Fly    60 NIIVTAAHCFFDEEGNRLDD----QGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAI 120

  Fly   125 VRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTY 189
            |||.|.|.|.|.::.|.:|...|...|.|.:||||.:..  .:.:|.|: .|.:.|.:....|.:
  Fly   121 VRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYI--LNDSTNLY-PTHLQGLALHIKSIF 182

  Fly   190 GYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVL 254
            ....| ..:::||....:.||.||||||||...||||||||||...|::  ..:.::...|:|:|
  Fly   183 SCRLF-DPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFFVSVPYFREWIL 244

  Fly   255 QA 256
            .|
  Fly   245 NA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 95/226 (42%)
Tryp_SPc 35..253 CDD:238113 94/225 (42%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 95/226 (42%)
Tryp_SPc 27..243 CDD:238113 94/225 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.