DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG17239

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:223 Identity:107/223 - (47%)
Similarity:139/223 - (62%) Gaps:5/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYG 98
            |||||...:|...|||.|:.|.|...||.:|.|.:|::|||||| |......|.:|.||:...:|
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCL-TDRETEFLSVRVGSSFTFFG 86

  Fly    99 GVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTST 163
            |.:|.|:::..||.|: .|..|||.|:||::||..||.:..|.:|...||.||.|::||||....
  Fly    87 GQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGF 150

  Fly   164 DGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVV 228
            ......::|.....||.:.||..|   ||..|...||||||..||||.||||||||||.:|||:|
  Fly   151 KKNYPMSILSASVDIVDQDQCRRS---YGRKITKDMICAAAPGKDACSGDSGGPLVSGNKLVGIV 212

  Fly   229 SWGRDCAVANYPGVYANIAELRDWVLQA 256
            |:|::||...|||||||:|||:.|:|.|
  Fly   213 SFGKECAHPEYPGVYANVAELKPWILGA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 104/218 (48%)
Tryp_SPc 35..253 CDD:238113 103/217 (47%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 104/218 (48%)
Tryp_SPc 24..237 CDD:238113 103/217 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443205
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.