DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG34458

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:259 Identity:84/259 - (32%)
Similarity:127/259 - (49%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68
            |:...:.|||:|   .:...::....|   ||:||..::....|.|||||.:|.|.||||:||:.
  Fly     7 LVKLSILLLAVT---FVHSDMDVAEES---RIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDT 65

  Fly    69 IIVTAAHCL--DTPTTVSNLRIRAGSNKRTYG-GVLVEVAAIKAHEAYNSNSKINDIGVVRLKTK 130
            :|||||||.  ..|   ..::...|:|..:.| |....:|....|..||..|:..|:.:::|.:.
  Fly    66 MIVTAAHCTMGQNP---GQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSP 127

  Fly   131 LTFGSTIKAITMASATP--AHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGS 193
            :..|..::.|.:|.:..  |..:.|.|||:|..:.:......|.|...::..|..|.|...   .
  Fly   128 VPMGGAVQTIQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNI---P 189

  Fly   194 FIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
            .:...|:||.  :....:|||||||||...|:|.||||||..|.....|.:|..:..||.|:.|
  Fly   190 GLTDRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 76/225 (34%)
Tryp_SPc 35..253 CDD:238113 75/224 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 76/225 (34%)
Tryp_SPc 32..254 CDD:238113 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452431
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.