DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG34457

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster


Alignment Length:159 Identity:37/159 - (23%)
Similarity:64/159 - (40%) Gaps:43/159 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKA 139
            :||:....| |.:     .:|..|.:|||    ||...|::..|  :|.:...|..:.||:.::.
  Fly    28 NCLEEDKIV-NFK-----KQRDRGELLVE----KARTLYDNFHK--EIVLAAPKQTIIFGAIVQL 80

  Fly   140 ITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA 204
            :      |.|   .:||....|..   ::|..:.::.::|.:||.          |......:.|
  Fly    81 M------PIH---INISDMDTTDL---NAALSVVINEKVVRKSQS----------INEDCELSVA 123

  Fly   205 TNKDACQGDSGGPLVSGGQLVGVVSWGRD 233
            .:|..|..:| ..:|||.        |||
  Fly   124 PSKRPCVRNS-FKIVSGD--------GRD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 37/159 (23%)
Tryp_SPc 35..253 CDD:238113 37/159 (23%)
CG34457NP_001097339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.