DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:85 Identity:31/85 - (36%)
Similarity:46/85 - (54%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 IVGRSQCGSSTYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLV----GVVSWGRDCAV 236
            :|..|.|.:.   .|:.|...|:||...  .||.||||||||:||....|    |::|.|.||..
Zfish    23 VVINSDCNNL---LGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQSGIISKGHDCGQ 84

  Fly   237 ANYPGVYANIAELRDWVLQA 256
            ...||||..:::.::|::.:
Zfish    85 PYEPGVYTRVSQYQNWIMSS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 30/80 (38%)
Tryp_SPc 35..253 CDD:238113 30/80 (38%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.