DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk4

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:254 Identity:76/254 - (29%)
Similarity:115/254 - (45%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLALLAL-TNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIV 71
            ||..|.| ..||        ..||:..||:.|...|...:|||.:|......||.|.::....::
Mouse    12 FLGCLILEVTGA--------SASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVL 68

  Fly    72 TAAHCLDTPTTVS----NLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132
            :|||||.....|.    ||:   ||.:.  |..::|......|..:|..|..||:.:::|...:.
Mouse    69 SAAHCLQESYIVGLGLHNLK---GSQEP--GSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVI 128

  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKA 197
            ..:||::|.:|:..|..|....:||||:.. :|...:.|..|:..:.....|   ...|......
Mouse   129 ESNTIRSIPVATQCPTPGDTCLVSGWGQLK-NGKLPSLLQCVNLSVASEETC---RLLYDPVYHL 189

  Fly   198 TMICAAA--TNKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYANIAELRDWV 253
            :|.||..  ..||:|.||||||:|....|.|:||.|: .|.....|.||.|:.:..:|:
Mouse   190 SMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 67/225 (30%)
Tryp_SPc 35..253 CDD:238113 66/224 (29%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.