DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and AZU1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:269 Identity:72/269 - (26%)
Similarity:113/269 - (42%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFLALLALTNGAVIPIGLEPQTSSLGGR-----IVGGTASSIEDRPWQVSLQRSGSHFCGGSIIS 66
            |.|.:|||..|.:        .||..|.     ||||..:.....|:..|:|..|.|||||::|.
Human     2 TRLTVLALLAGLL--------ASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIH 58

  Fly    67 NNIIVTAAHCLDTP----TTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIG 123
            ...::|||.|..:.    :||    .:||.|...:::|:.      .:..:...|:....:||:.
Human    59 ARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFS------ISSMSENGYDPQQNLNDLM 117

  Fly   124 VVRL--KTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGS 186
            :::|  :..||...||..:.:.:||...|:...::|||...:.|..|....||:..:....||  
Human   118 LLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC-- 180

  Fly   187 STYGYGSFIKATMICAAATNK--DACQGDSGGPLVSGGQLVGVVSW-----GRDCAVANYPGVYA 244
                     :...:|.....:  ..|.||.|.|||..|...||.|:     ||.      |..:.
Human   181 ---------RPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRG------PDFFT 230

  Fly   245 NIAELRDWV 253
            .:|..|||:
Human   231 RVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 62/240 (26%)
Tryp_SPc 35..253 CDD:238113 62/234 (26%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 63/236 (27%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.