DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and KLK10

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:282 Identity:71/282 - (25%)
Similarity:118/282 - (41%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIP---IGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGG 62
            ::.|:...:|.|.....|::|   ..|:|:..        |:..:...:||||||....|..|.|
Human    17 LAKLLPLLMAQLWAAEAALLPQNDTRLDPEAY--------GSPCARGSQPWQVSLFNGLSFHCAG 73

  Fly    63 SIISNNIIVTAAHCLDTPTTVSNLRIRAGSN----------KRTYGGVLVEVAAIKAHEAYNSNS 117
            .::..:.::|||||.:.|     |..|.|.:          :||...|:        |..|:..|
Human    74 VLVDQSWVLTAAHCGNKP-----LWARVGDDHLLLLQGEQLRRTTRSVV--------HPKYHQGS 125

  Fly   118 --------KINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTS------TDGPSS 168
                    ..:|:.:::|...:..|..::|:.:.......|....::|||.|:      ..|.:.
Human   126 GPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTC 190

  Fly   169 ATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA-TNKDACQGDSGGPLVSGGQLVGVVSWG- 231
            :::     .|:...:|   ...|...:...||||.. ..:|.||.|||||||....|.|::||| 
Human   191 SSI-----TILSPKEC---EVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGV 247

  Fly   232 RDCAVANYPGVYANIAELRDWV 253
            ..|..|.:|.||..|.:...|:
Human   248 YPCGSAQHPAVYTQICKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 63/244 (26%)
Tryp_SPc 35..253 CDD:238113 63/243 (26%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 64/242 (26%)
Tryp_SPc 49..269 CDD:214473 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.