DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk11

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:255 Identity:81/255 - (31%)
Similarity:127/255 - (49%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IGLEPQTSSLGG--RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTV- 83
            |.|...|..:||  ||:.|.......:||||:|.:.....||.::|:...::|||||......: 
Mouse    33 IALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPHYVIL 97

  Fly    84 ---SNLRIRAGSNKRTYGGVLVEVAAIKA--HEAYNSN----SKINDIGVVRLKTKLTFGSTIKA 139
               .||....|..:|.        .|.::  |..:|::    ...|||.:|::.:.:.|...::.
Mouse    98 LGEHNLEKTDGCEQRR--------MATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAVQP 154

  Fly   140 ITMASATPAHGSAASISGWGKTSTDG---PSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMIC 201
            :|::....|.|::..|||||.||:..   |.|  |...:..|:...:|..:   |...|..||:|
Mouse   155 LTLSPHCVAAGTSCLISGWGTTSSPQLRLPHS--LRCANVSIIEHKECEKA---YPGNITDTMLC 214

  Fly   202 AAA--TNKDACQGDSGGPLVSGGQLVGVVSWGRD-CAVANYPGVYANIAELRDWVLQAQK 258
            |:.  ..||:||||||||||..|.|.|::|||:| |||...||||..:.:..:|:.:..:
Mouse   215 ASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNWIHEVMR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 75/234 (32%)
Tryp_SPc 35..253 CDD:238113 74/233 (32%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 75/234 (32%)
Tryp_SPc 48..272 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.