DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and KLK6

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:234 Identity:78/234 - (33%)
Similarity:110/234 - (47%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTV----SNLRIRAGSNK 94
            ::|.|........|:|.:|..||...|||.:|....::|||||......|    .|||.|..|.:
Human    21 KLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVFLGKHNLRQRESSQE 85

  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWG 159
            ::      .|.....|..|::.|...||.::||.........|:.:.:.....|:.::..|.|||
Human    86 QS------SVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWG 144

  Fly   160 KTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGG 222
            ||: ||....|:......:|.|.:|   .:.|...|...|:||.  ...||:||||||||||.|.
Human   145 KTA-DGDFPDTIQCAYIHLVSREEC---EHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGD 205

  Fly   223 QLVGVVSWGR-DCAVANYPGVYANIAELRDWVLQAQKTV 260
            .|.|:||||. .|.....||||.|:....:|:   |||:
Human   206 HLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWI---QKTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 74/225 (33%)
Tryp_SPc 35..253 CDD:238113 74/224 (33%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 74/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.