DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS3

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:229 Identity:86/229 - (37%)
Similarity:121/229 - (52%) Gaps:21/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTV----SNLRIRAGSNK 94
            :||||........|:|||| .|||||||||:||...:|:||||..|...|    .|:::..|:.:
Human   109 KIVGGYTCEENSLPYQVSL-NSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQ 172

  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWG 159
                  .:..|.|..|..||.::..|||.:::|.:.....:.:..|::.:..||.|:...|||||
Human   173 ------FINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWG 231

  Fly   160 KT---STDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLV 219
            .|   ..|.|..  |..:|..::.:::|.:|   |...|..:|.|..  ...||:||.|||||:|
Human   232 NTLSFGADYPDE--LKCLDAPVLTQAECKAS---YPGKITNSMFCVGFLEGGKDSCQRDSGGPVV 291

  Fly   220 SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ..|||.||||||..||..|.||||..:....||:
Human   292 CNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 85/227 (37%)
Tryp_SPc 35..253 CDD:238113 85/226 (38%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 85/227 (37%)
Tryp_SPc 110..328 CDD:238113 86/228 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.