DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS2

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:268 Identity:95/268 - (35%)
Similarity:133/268 - (49%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67
            |||.||:|       |.:....:..     .:||||........|:|||| .||.||||||:||.
Human     4 LLILTFVA-------AAVAAPFDDD-----DKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISE 55

  Fly    68 NIIVTAAHCLDTPTT---------VSNLRIRAGS-NKRTYGG--VLVEVAAIKAHEAYNSNSKIN 120
            ..:|:|.||..:...         ...:::|.|. |.....|  ..:..|.|..|..|||.:..|
Human    56 QWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDN 120

  Fly   121 DIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDG---PSSATLLFVDTRIVGRS 182
            ||.:::|.:.....|.:.||::.:|.||.|:.:.|||||.|.:.|   |..  |..:|..::.::
Human   121 DILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDE--LQCLDAPVLSQA 183

  Fly   183 QCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYAN 245
            :|.:|   |...|...|.|..  ...||:||||||||:||.|:|.|:||||..||..|.||||..
Human   184 ECEAS---YPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTK 245

  Fly   246 IAELRDWV 253
            :....||:
Human   246 VYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 87/235 (37%)
Tryp_SPc 35..253 CDD:238113 87/234 (37%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 87/235 (37%)
Tryp_SPc 24..256 CDD:238113 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.