DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and KLK15

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:274 Identity:85/274 - (31%)
Similarity:124/274 - (45%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68
            |:.|...|||.|            .:..|.:::.|...:...:||||:|...|...||.|:||.:
Human     3 LLLTLSFLLAST------------AAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPH 55

  Fly    69 IIVTAAHCLDTPTTV----SNLRIRAGSNK-RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLK 128
            .:::||||......|    .|||.|.|..: ||...|:       .|..|.:.|..|||.::||.
Human    56 WVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVI-------PHPRYEARSHRNDIMLLRLV 113

  Fly   129 TKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSA-----------TLLFVDTRIVGRS 182
            ........::...:.:..|..|.|..:||||..|.:.|.:|           ||...:..|:..:
Human   114 QPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDT 178

  Fly   183 QCGSSTYGYGSFIKATMICAAATNK--DACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYA 244
            .|..|   |...:..||:||.|..:  ::|:||||||||.||.|.|:||||. .|.....||||.
Human   179 SCDKS---YPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYT 240

  Fly   245 NIAELRDWVLQAQK 258
            .:....:|:.:..|
Human   241 KVCHYLEWIRETMK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 76/237 (32%)
Tryp_SPc 35..253 CDD:238113 76/236 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.