DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and zgc:112038

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:270 Identity:89/270 - (32%)
Similarity:141/270 - (52%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALTNGAVIPI---GLEPQTSSLGG-RIVGGTASSIEDRPWQVSLQRSG--SHFCGGSIISNNI 69
            ||....||:..:   |..|..::.|| ..|.|:      .|||.|:.|..  .|.||||:|:.:.
Zfish    13 LLLNIAGALCQLDVCGQAPLNNNNGGDDAVAGS------WPWQASIHRISPEDHICGGSLINKDW 71

  Fly    70 IVTAAHCLDTPTTVSNLRI------RAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLK 128
            :::||||. ..|..:|::|      :.|||.......|.::.   .|..|::.::.|||.::||.
Zfish    72 VLSAAHCF-MITATANIKIFLGRQFQTGSNPNEISRTLTQIV---IHPDYSTTTQNNDIALLRLS 132

  Fly   129 TKLTFGSTIKAITMASATP--AHGSAASISGWGK-TSTDGPSSATLLFVDTRIVGRSQCGSSTYG 190
            :.:||...|:.:.:|||..  |.|:.:.|:||.| .|:|...:..|..|...:|..::|.:.   
Zfish   133 SSVTFTDYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNAD--- 194

  Fly   191 YGSFIKATMICAAAT--NKDACQGDSGGPLVS--GGQLV--GVVSWGRDCAVANYPGVYANIAEL 249
            |...|...||||...  .|||||||||||:||  |.:.:  |:||:||:|.:..|||:|..:::.
Zfish   195 YKGIITDNMICAGINEGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQY 259

  Fly   250 RDWVLQAQKT 259
            :.|:....:|
Zfish   260 QSWITSELRT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 79/235 (34%)
Tryp_SPc 35..253 CDD:238113 79/234 (34%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 81/238 (34%)
Tryp_SPc 37..263 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.