DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and ctrb.3

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:268 Identity:93/268 - (34%)
Similarity:131/268 - (48%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQR-SGSHFCGGSIIS 66
            |.:.:.:|..:...|..:| .:.|..|.. .|||.|..:.....|||||||. :|.||||||:|:
Zfish     4 LWLLSCVAFFSAAYGCGVP-AIPPVVSGY-ARIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLIN 66

  Fly    67 NNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIK-----AHEAYNSNSKINDIGVVR 126
            ...:||||||    :..::.|:..|.:.:.......::..:|     .|..||||:..|||.:|:
Zfish    67 EFWVVTAAHC----SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVK 127

  Fly   127 LKTKLTFGSTIKAITMASATP--AHGSAASISGWGKTSTDG---PSSATLLFVDTRIVGRSQCGS 186
            |....:..:.:..:.:|.|:.  |.|.....||||.|..:.   |..  |..|...::....|.:
Zfish   128 LTAPASLNAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDE--LQQVALPLLSNEDCKN 190

  Fly   187 STYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQ----LVGVVSWGRDCAVANYPGVYANIA 247
            .   :||.|:.|||||.|....:|.||||||||....    |||:||||........||||..:.
Zfish   191 H---WGSNIRDTMICAGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSRCDPTMPGVYGRVT 252

  Fly   248 ELRDWVLQ 255
            ||||||.|
Zfish   253 ELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 84/233 (36%)
Tryp_SPc 35..253 CDD:238113 83/232 (36%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 84/233 (36%)
Tryp_SPc 34..261 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.