DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Tpsab1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:271 Identity:86/271 - (31%)
Similarity:126/271 - (46%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGS---HFCGG 62
            :.||:.|...|.:|.:.|       |..:.....||||..:|....||||||:.:.:   |||||
  Rat    39 LKLLLLTLPLLSSLVHAA-------PSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGG 96

  Fly    63 SIISNNIIVTAAHCLDTPTTVSN-LRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVR 126
            |:|....::|||||:.......| ||::.......|...|:.|:.|.:|..:.......||.:::
  Rat    97 SLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLK 161

  Fly   127 LKTKLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTDG--PSSATLLFVDTRIVGRSQC--- 184
            |...:...|.:..:::  ||.|...|:...::|||..:.|.  |....|..|...||....|   
  Rat   162 LTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLK 226

  Fly   185 ---GSSTYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQ----LVGVVSWGRDCAVANYPGV 242
               |.:|......::..|:||.....|:||||||||||...:    ..||||||..||..|.||:
  Rat   227 YHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGI 291

  Fly   243 YANIAELRDWV 253
            |..:....||:
  Rat   292 YTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 78/236 (33%)
Tryp_SPc 35..253 CDD:238113 78/235 (33%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 78/235 (33%)
Tryp_SPc 66..302 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.