DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and alphaTry

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:260 Identity:148/260 - (56%)
Similarity:192/260 - (73%) Gaps:7/260 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67
            |.|...|:.:....|..:|.||.||   |.||||||:|::|...|||:||||||||.|||||.|.
  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQ---LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSA 63

  Fly    68 NIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132
            ||||||||||.: .:.|.|::||||...:.|||:.:|::.|.||.||:|:.:|||.|:||.:.|:
  Fly    64 NIIVTAAHCLQS-VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127

  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTSTDGPSS--ATLLFVDTRIVGRSQCGSSTYGYGSFI 195
            |.|:||||::|:..||:|::|::|||| |.:.|.||  :.|.:|:..||.:|||.||||||||.|
  Fly   128 FSSSIKAISLATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191

  Fly   196 KATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            :.|||||||:.||||||||||||||||.||||||||..||.:|||||||::|.||.||:....::
  Fly   192 RNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANSI 256

  Fly   261  260
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 135/220 (61%)
Tryp_SPc 35..253 CDD:238113 134/219 (61%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 135/220 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443156
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
1110.910

Return to query results.
Submit another query.