DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and zgc:92590

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:236 Identity:77/236 - (32%)
Similarity:117/236 - (49%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLGGRIVGGTASSIEDRPWQVSL-QRSGSHFCGGSIISNNIIVTAAHC------LDTPTTVSNLR 87
            |...:|:||...|...:|||:.| ..:|..:||.|:|::...|:||||      |.......|:.
Zfish    16 SADDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLVANRLTVHLGEHNVA 80

  Fly    88 IRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSA 152
            :..|:.:|      ::...:..|..||..:..||..:::||....|...::.:.:.::..:.|..
Zfish    81 VEEGTEQR------IKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQ 139

  Fly   153 ASISGWGKTSTDG---PSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQG 212
            ..:||||.....|   |.  .|..::..::.|:||..:   ||..|...|.||.  ...||||||
Zfish   140 CLVSGWGNLINTGVVYPD--VLQCLNLPVLTRAQCEGA---YGWQITKNMFCAGFMEGGKDACQG 199

  Fly   213 DSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |||||::..|:|.||||||..||.:.|||||..:....|||
Zfish   200 DSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 74/230 (32%)
Tryp_SPc 35..253 CDD:238113 74/229 (32%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 74/230 (32%)
Tryp_SPc 21..243 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.