DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and ctrl

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:273 Identity:101/273 - (36%)
Similarity:142/273 - (52%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRS-GSHFCGGSIIS 66
            |.|.:..||:|.|.|..:| .::|..|.. .|||.|..:.....|||||||:| |.||||||:|:
Zfish     2 LWIISCFALVASTLGCGVP-AIKPVISGY-NRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLIN 64

  Fly    67 NNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYG----GVLVEVAAIKA------HEAYNSNSKIND 121
            ...:||||||          |::||.:....|    |...|...:|:      |..|||.:..||
Zfish    65 QYWVVTAAHC----------RVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNND 119

  Fly   122 IGVVRLKTKLTFGSTIKAITMASATPA--HGSAASISGWGKTSTDGPSSATLLFVDTR--IVGRS 182
            |.:::|.:.....|.|..:.:|:::.:  .|:....:|||||   |.:|:..:...|.  ::..:
Zfish   120 ITLLKLSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGWGKT---GSTSSPRILQQTALPLLSPA 181

  Fly   183 QCGSSTYGYGSFIKATMICAAATNKDACQGDSGGPLV---SGG-QLVGVVSWG-RDCAVANYPGV 242
            ||  ..|...:.|...||||.|:...:||||||||||   ||. ..||:|||| .||.|.. |.|
Zfish   182 QC--KQYWGQNRITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRT-PAV 243

  Fly   243 YANIAELRDWVLQ 255
            ||.::.||.|:.|
Zfish   244 YARVSYLRQWIDQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 89/238 (37%)
Tryp_SPc 35..253 CDD:238113 88/237 (37%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 89/238 (37%)
Tryp_SPc 32..257 CDD:238113 90/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.