DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Gm5771

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:267 Identity:95/267 - (35%)
Similarity:142/267 - (53%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            ||.|:  ||||:    ||.:...::..      :||||........|:|||| .||.||||||:|
Mouse     1 MSALL--FLALV----GAAVAFPVDDD------KIVGGYTCRENSVPYQVSL-NSGYHFCGGSLI 52

  Fly    66 SNNIIVTAAHCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVR 126
            ::..:|:||||..|...|    .|:::..|:.:      .|..|.|..|..:|..:..|||.:::
Mouse    53 NDQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQ------FVNAAKIIKHPNFNRKTLNNDIMLIK 111

  Fly   127 LKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYG 190
            |.:.:|..:.:..:.:.|:....|:...|||||.|.:.|.|...|| .:|..::.::.|.:|   
Mouse   112 LSSPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEAS--- 173

  Fly   191 YGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |...|...|:||.  ...||:||||||||:|..|:|.|:||||..||:|:.||||..:....||:
Mouse   174 YPGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWI 238

  Fly   254 LQAQKTV 260
               |.|:
Mouse   239 ---QDTI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 83/225 (37%)
Tryp_SPc 35..253 CDD:238113 83/224 (37%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 83/225 (37%)
Tryp_SPc 23..241 CDD:238113 85/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.