DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG7829

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:225 Identity:91/225 - (40%)
Similarity:131/225 - (58%) Gaps:7/225 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLD-TPTTVSNLRIRAGSNKRTY 97
            |||||..:.|.:.|:.||:|..|.|.||||||:|:.|:||.|||: .|..:..::: .|:::...
  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKV-GGTSRYRK 90

  Fly    98 GGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTS 162
            .|.|..||.::.||.:|..:...|||::||...||....:|||.:.....|.|:.|:|:|||..|
  Fly    91 DGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKS 155

  Fly   163 TDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLV 225
            .:||.|.:|.:....||.::.|.:.   .|..:...|:||.  ....||||.||||||....|||
  Fly   156 MNGPPSDSLRYARVPIVNQTACRNL---LGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLV 217

  Fly   226 GVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
            |:||||..||:|:.||||:.:..|..|:.|
  Fly   218 GIVSWGVGCALADKPGVYSRLDALHPWLDQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 89/221 (40%)
Tryp_SPc 35..253 CDD:238113 88/220 (40%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 89/220 (40%)
Tryp_SPc 28..248 CDD:238113 90/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.